Home
Sign In
Guide > On site repair in Texas > On site repair in Denton

On site repair in Denton, Texas

45 results found

Search for local businesses, places and services near you

Choose your location:
Texas
  • United States
  • Alabama
  • Alaska
  • Arizona
  • Arkansas
  • California
  • Colorado
  • Connecticut
  • Delaware
  • Florida
  • Georgia
  • Hawaii
  • Idaho
  • Illinois
  • Indiana
  • Iowa
  • Kansas
  • Kentucky
  • Louisiana
  • Maine
  • Maryland
  • Massachusetts
  • Michigan
  • Minnesota
  • Mississippi
  • Missouri
  • Montana
  • Nebraska
  • Nevada
  • New Hampshire
  • New Jersey
  • New Mexico
  • New York
  • North Carolina
  • North Dakota
  • Ohio
  • Oklahoma
  • Oregon
  • Pennsylvania
  • Rhode Island
  • South Carolina
  • South Dakota
  • Tennessee
  • Texas
  • Utah
  • Vermont
  • Virginia
  • Washington
  • West Virginia
  • Wisconsin
  • Wyoming
  • Australia
  • France
  • Germany
  • Ireland
  • Italy
  • New Zealand
  • Poland
  • Spain
  • Ukraine
  • United Kingdom
View Map
  • 1
  • 2
  • 5 23
    #1

    On Site Catalytic Converter Replacement

    ● Closed
    8356 Thompson Rd Suite E, Northlake, TX 76247, United States
    940-373-1833
    converterreplacement.com

    On Site Catalytic Converter Replacement is a car repair institution located at 8356 Thompson Road in Northlake, Texas, United States.

    Photo of On Site Catalytic Converter Replacement - Northlake, TX 76247, USA Photo of On Site Catalytic Converter Replacement - Northlake, TX 76247, USA Photo of On Site Catalytic Converter Replacement - Northlake, TX 76247, USA
    Auto Repair
    Details
  • 4.9 40
    #2

    JBRV Mobile RV Repair

    ● Open
    613 Rdg Vw Wy, Justin, TX 76247, United States
    816-844-0088
    jbrvmobilervrepair.com

    JBRV Mobile RV Repair, located at 613 Ridge View Way in Justin, Texas, offers premier mobile RV repair services to keep you on the road and out of the shop.

    Photo of JBRV Mobile RV Repair - Justin, TX 76247, USA Photo of JBRV Mobile RV Repair - Justin, TX 76247, USA Photo of JBRV Mobile RV Repair - Justin, TX 76247, USA
    Auto Repair
    Details
  • 4.9 70
    #3

    NuBrakes Mobile Brake Repair

    ● Closed
    4980 W University Dr, Prosper, TX 75078, United States
    469-829-4988
    nubrakes.com

    Welcome to NuBrakes Mobile Brake Repair, the premier mobile brake repair service in Dallas, conveniently located at 4980 W University Dr, Prosper, TX 75078.

    Photo of NuBrakes Mobile Brake Repair - Prosper, TX 75078, USA Photo of NuBrakes Mobile Brake Repair - Prosper, TX 75078, USA Photo of NuBrakes Mobile Brake Repair - Prosper, TX 75078, USA
    Auto Repair
    Details
  • 4.6 55
    #4

    Dan’s auto body repair

    ● Closed
    1557 Summerwind Ln, Lewisville, TX 75077, United States
    972-786-6409
    dans-auto-bodywork-mobile-and-bumper-repair.business.site

    Dan's Auto Body Repair is a trusted car repair institution located at 1557 Summerwind Lane in Lewisville, Texas.

    Photo of Dan’s auto body repair - Lewisville, TX 75077, USA Photo of Dan’s auto body repair - Lewisville, TX 75077, USA Photo of Dan’s auto body repair - Lewisville, TX 75077, USA
    Auto Repair
    Details
  • 4.4 577
    #5

    Denton County Animal ER

    ● Closed
    4145 South Interstate 35 E # 101, Denton, TX 76210, United States
    940-271-1200
    dcaer.com

    Denton County Animal ER is a leading veterinary care institution located in Denton, Texas, United States. We specialize in providing high quality after-hours emergency care to pets and are recognized as a compassionate and skilled emergency care provider.

    Photo of Denton County Animal ER - Denton, TX 76210, USA Photo of Denton County Animal ER - Denton, TX 76210, USA Photo of Denton County Animal ER - Denton, TX 76210, USA
    Medical Services Veterinary Care
    Details
  • 4.3 91
    #6

    Technician's On Wheels

    ● Closed
    718 E Hundley Dr, Lake Dallas, TX 75065, United States
    940-321-3214
    techniciansonwheels.net

    Technician's On Wheels is a premier car repair institution located at 718 East Hundley Drive in Lake Dallas, Texas. Our team of skilled technicians is dedicated to providing top-notch automotive services on the go.

    Photo of Technician's On Wheels - Lake Dallas, TX 75065, USA Photo of Technician's On Wheels - Lake Dallas, TX 75065, USA Photo of Technician's On Wheels - Lake Dallas, TX 75065, USA
    Auto Repair
    Details
  • 5 8
    #7

    Rolling Wrenches RV Mobile Repair

    ● Open
    2141 Mahogany St, Flower Mound, TX 75022, United States
    909-801-0303
    facebook.com

    Rolling Wrenches RV Mobile Repair is a convenient and reliable car repair service located at 2141 Mahogany Street in Flower Mound, Texas, United States.

    Photo of Rolling Wrenches RV Mobile Repair - Flower Mound, TX 75022, USA Photo of Rolling Wrenches RV Mobile Repair - Flower Mound, TX 75022, USA Photo of Rolling Wrenches RV Mobile Repair - Flower Mound, TX 75022, USA
    Auto Repair
    Details
  • 5 1
    #8

    HERCULES Project & Repair Services

    ● Open
    5314 Countess Ct, Lake Dallas, TX 75065, United States
    682-433-3478
    hercules-project-repair-services.business.site

    HERCULES Project & Repair Services is a leading general contractor located at 5314 Countess Court in Lake Dallas, Texas, United States.

    Photo of HERCULES Project & Repair Services - Lake Dallas, TX 75065, USA Photo of HERCULES Project & Repair Services - Lake Dallas, TX 75065, USA Photo of HERCULES Project & Repair Services - Lake Dallas, TX 75065, USA
    General Contractor
    Details
  • 5 1
    #9

    Mobile HVAC Repair Service Fort Worth

    ● Open
    2157 Eagle Pkwy, Fort Worth, TX 76177, United States
    817-259-1422
    mobile-hvac-repair-service-fort.business.site

    Mobile HVAC Repair Service Fort Worth is a trusted general contractor specializing in providing top-notch heating, ventilation, and air conditioning repair services on the go in Fort Worth, Texas.

    Photo of Mobile HVAC Repair Service Fort Worth - Fort Worth, TX 76177, USA Photo of Mobile HVAC Repair Service Fort Worth - Fort Worth, TX 76177, USA
    General Contractor
    Details
  • 5 1
    #10

    Solid State Exchange & Repair Co.

    ● Closed
    4701 Spartan Dr, Denton, TX 76207, United States
    877-874-7349
    solidstaterepair.com

    Solid State Exchange & Repair Co. is a trusted store located at 4701 Spartan Drive in Denton, Texas, United States.

    Store
    Details
  • 5 16
    #11

    All-Tex Ice Machine Repair, Sales & Leasing

    ● Closed
    3217 Gidran Dr, Fort Worth, TX 76244, United States
    940-626-1423
    alltexice.com

    All-Tex Ice Machine Repair, Sales & Leasing is the top team in the area for all your commercial ice machine needs.

    Photo of All-Tex Ice Machine Repair, Sales & Leasing - Fort Worth, TX 76244, USA Photo of All-Tex Ice Machine Repair, Sales & Leasing - Fort Worth, TX 76244, USA Photo of All-Tex Ice Machine Repair, Sales & Leasing - Fort Worth, TX 76244, USA
    Details
  • 5 3
    #12

    Denton Garage Doors Co.

    ● Open
    5011 W University Dr, Denton, TX 76207, United States
    940-251-3881
    dentongaragedoorsco.business.site

    Denton Garage Doors Co. is a trusted and reliable garage door installation and repair company located at 5011 West University Drive in Denton, Texas.

    Photo of Denton Garage Doors Co. - Denton, TX 76207, USA Photo of Denton Garage Doors Co. - Denton, TX 76207, USA Photo of Denton Garage Doors Co. - Denton, TX 76207, USA
    Details
  • 4.8 16
    #13

    Dynamic Fleet Services and Repair

    ● Open
    2401 Worthington Dr #118, Denton, TX 76207, United States
    817-997-4682
    dynamicfleetservicesandrepair.com

    Dynamic Fleet Services and Repair is a car repair institution located at 2401 Worthington Drive in Denton, Texas.

    Photo of Dynamic Fleet Services and Repair - Denton, TX 76207, USA Photo of Dynamic Fleet Services and Repair - Denton, TX 76207, USA Photo of Dynamic Fleet Services and Repair - Denton, TX 76207, USA
    Auto Repair
    Details
  • 4.8 17
    #14

    JB Collision Repair

    ● Closed
    306 E Purnell St, Lewisville, TX 75057, United States
    972-999-7955
    jb-collision-repair.business.site

    JB Collision Repair is a premier car repair institution located at 306 East Purnell Street in Lewisville, Texas.

    Photo of JB Collision Repair - Lewisville, TX 75057, USA
    Auto Repair
    Details
  • 4.4 7
    #15

    On Site Diesel Repair

    ● Open
    9955 Field Lark Ln, Sanger, TX 76266, United States
    940-999-7477
    onsitedieselrepairntx.com

    On Site Diesel Repair is a trusted car repair institution located at 9955 Field Lark Lane in Sanger, Texas. Specializing in diesel vehicles, our skilled technicians provide on-the-spot repair services to get you back on the road quickly and safely.

    Photo of On Site Diesel Repair - Sanger, TX 76266, USA Photo of On Site Diesel Repair - Sanger, TX 76266, USA Photo of On Site Diesel Repair - Sanger, TX 76266, USA
    Auto Repair
    Details
  • 3.5 48
    #16

    Robert's Paint-Collision & Mechanical Repair

    ● Closed
    4213 Mesa Dr, Denton, TX 76207, United States
    940-383-3695
    roberts-paint-collision-mechanical-repair.business.site

    Robert's Paint-Collision & Mechanical Repair is a premier car repair and car wash institution located at 4213 Mesa Drive in Denton, Texas, United States.

    Photo of Robert's Paint-Collision & Mechanical Repair - Denton, TX 76207, USA Photo of Robert's Paint-Collision & Mechanical Repair - Denton, TX 76207, USA Photo of Robert's Paint-Collision & Mechanical Repair - Denton, TX 76207, USA
    Auto Repair Auto Wash
    Details
  • 3.8 5
    #17

    ECO Heavy Equipment Onsite Service & Repair LLC

    ● Open
    600 Harbour Town Dr, Lake Dallas, TX 75065, United States
    682-498-0505
    sites.google.com

    ECO Heavy Equipment Onsite Service & Repair LLC is a premier institution located at 600 Harbour Town Drive in Lake Dallas, Texas, United States.

    Photo of ECO Heavy Equipment Onsite Service & Repair LLC - Lake Dallas, TX 75065, USA Photo of ECO Heavy Equipment Onsite Service & Repair LLC - Lake Dallas, TX 75065, USA Photo of ECO Heavy Equipment Onsite Service & Repair LLC - Lake Dallas, TX 75065, USA
    Details
  • 5 48
    #18

    Five Star Mobile Detailing and Tint

    ● Open
    4409 Chicory Ct, Denton, TX 76210, United States
    940-999-8294
    fivestarmobiledetailing.com

    Five Star Mobile Detailing and Tint is a top-rated car repair institution located at 4409 Chicory Court in Denton, Texas.

    Photo of Five Star Mobile Detailing and Tint - Denton, TX 76210, USA Photo of Five Star Mobile Detailing and Tint - Denton, TX 76210, USA Photo of Five Star Mobile Detailing and Tint - Denton, TX 76210, USA
    Auto Repair
    Details
  • 5 161
    #19

    Kyle Aubry - State Farm Insurance Agent

    ● Closed
    3044 Old Denton Rd Apt 315, Carrollton, TX 75007, United States
    972-245-5953
    agentaubry.com

    Kyle Aubry - State Farm Insurance Agent is an insurance agency located at 3044 Old Denton Road in Carrollton, Texas. Our office is conveniently situated in the South East complex at the corner of Old Denton and Frankford, facing Frankford Rd.

    Photo of Kyle Aubry - State Farm Insurance Agent - Carrollton, TX 75007, USA Photo of Kyle Aubry - State Farm Insurance Agent - Carrollton, TX 75007, USA Photo of Kyle Aubry - State Farm Insurance Agent - Carrollton, TX 75007, USA
    Insurance Agency
    Details
  • 5 85
    #20

    Stitches and Staples Upholstery

    ● Closed
    1491 N Kealy Ave #46, Lewisville, TX 75057, United States
    972-672-3327

    Stitches and Staples Upholstery is a one-stop shop for all your home decor needs located at 1491 North Kealy Avenue in Lewisville, Texas.

    Photo of Stitches and Staples Upholstery - Lewisville, TX 75057, USA Photo of Stitches and Staples Upholstery - Lewisville, TX 75057, USA Photo of Stitches and Staples Upholstery - Lewisville, TX 75057, USA
    Food Establishment Furniture Store Home Goods Store Restaurant Store
    Details
  • 5 147
    #21

    BKS Home Services, LLC

    ● Closed
    8356 Thompson Rd, Northlake, TX 76247, United States
    316-303-4523
    bkshomeservices.business.site

    BKS Home Services, LLC is a versatile home maintenance institution based in Northlake, Texas. Our skilled team of professionals offer a range of services including electrical work, general contracting, and plumbing.

    Photo of BKS Home Services, LLC - Northlake, TX 76247, USA Photo of BKS Home Services, LLC - Northlake, TX 76247, USA Photo of BKS Home Services, LLC - Northlake, TX 76247, USA
    Electrician General Contractor Plumber
    Details
  • 5 41
    #22

    Mastertek service

    ● Closed
    2053 Terence Ln, Lewisville, TX 75067, United States
    469-315-2771

    Mastertek Service is a reputable institution located at 2053 Terence Lane in Lewisville, Texas, United States.

    Photo of Mastertek service - Lewisville, TX 75067, USA Photo of Mastertek service - Lewisville, TX 75067, USA Photo of Mastertek service - Lewisville, TX 75067, USA
    Details
  • 5 29
    #23

    AAS

    ● Open
    2701 Clark Dr, Corinth, TX 76210, United States
    214-616-3787
    alisairservice.com

    AAS is a reputable general contractor institution located at 2701 Clark Drive in Corinth, Texas, United States.

    General Contractor
    Details
  • 4.9 1,019
    #24

    Christian Brothers Automotive Flower Mound

    ● Closed
    1713 Justin Rd, Flower Mound, TX 75028, United States
    214-997-6448
    cbac.com

    Christian Brothers Automotive Flower Mound, located at 1713 Justin Road in Flower Mound, Texas, is your go-to destination for all your car repair needs. From oil changes to engine replacements, our experienced ASE-certified technicians can handle it all.

    Photo of Christian Brothers Automotive Flower Mound - Flower Mound, TX 75028, USA Photo of Christian Brothers Automotive Flower Mound - Flower Mound, TX 75028, USA Photo of Christian Brothers Automotive Flower Mound - Flower Mound, TX 75028, USA
    Auto Repair
    Details
  • 4.9 26
    #25

    R&M Auto Upholstery

    ● Closed
    505 Fort Worth Dr Ste.#108, Denton, TX 76201, United States
    940-514-1872
    rm-auto-upholstery.business.site

    R&M Auto Upholstery is a reputable car repair institution located at 505 Fort Worth Drive in Denton, Texas, United States.

    Photo of R&M Auto Upholstery - Denton, TX 76201, USA Photo of R&M Auto Upholstery - Denton, TX 76201, USA Photo of R&M Auto Upholstery - Denton, TX 76201, USA
    Auto Repair
    Details
  • 4.9 83
    #26

    Luigi's Autobody

    ● Closed
    4401 E McKinney St, Denton, TX 76208, United States
    214-281-7685
    luigis-autobody.business.site

    Luigi's Autobody is a trusted car repair institution located at 4401 East McKinney Street in Denton, Texas.

    Photo of Luigi's Autobody - Denton, TX 76208, USA Photo of Luigi's Autobody - Denton, TX 76208, USA Photo of Luigi's Autobody - Denton, TX 76208, USA
    Auto Repair
    Details
  • 4.9 96
    #27

    Tim Holland - State Farm Insurance Agent

    ● Closed
    5315 US-377 Bldg 1, Ste A, Aubrey, TX 76227, United States
    940-365-9449
    timhollandinsurancegroup.com

    Tim Holland - State Farm Insurance Agent is an insurance agency located at 5315 U.S. 377, Aubrey, Texas, United States.

    Photo of Tim Holland - State Farm Insurance Agent - Aubrey, TX 76227, USA Photo of Tim Holland - State Farm Insurance Agent - Aubrey, TX 76227, USA Photo of Tim Holland - State Farm Insurance Agent - Aubrey, TX 76227, USA
    Insurance Agency
    Details
  • 4.8 46
    #28

    Hair Studio 18

    ● Closed
    216 W Mulberry St, Denton, TX 76201, United States
    214-500-1323
    hair-studio-18.square.site

    Hair Studio 18 is a premier beauty salon located in the heart of Denton, Texas, on West Mulberry Street. Our experienced stylists are dedicated to providing top-notch hair care services to help you achieve the perfect look.

    Photo of Hair Studio 18 - Denton, TX 76201, USA Photo of Hair Studio 18 - Denton, TX 76201, USA Photo of Hair Studio 18 - Denton, TX 76201, USA
    Beauty Salon Hair Salon
    Details
  • 4.8 22
    #29

    TLG Delivery Center

    ● Closed
    1012 N Masch Branch Rd, Denton, TX 76207, United States
    940-783-9000
    tlgtrucks.com

    The TLG Delivery Center, located at 1012 North Masch Branch Road in Denton, Texas, is a premier store specializing in commercial trucks.

    Photo of TLG Delivery Center - Denton, TX 76207, USA Photo of TLG Delivery Center - Denton, TX 76207, USA Photo of TLG Delivery Center - Denton, TX 76207, USA
    Store
    Details
  • 4.8 107
    #30

    Local Circuit

    ● Closed
    101 S Locust St Ste B-02, Denton, TX 76201, United States
    940-484-8999
    thelocalcircuit.com

    Local Circuit is a trusted technology partner located at 101 South Locust Street, Denton, Texas, United States. With a customer-first mentality, we have been serving small businesses for over 15 years, providing fine-tuned I.T.

    Photo of Local Circuit - Denton, TX 76201, USA Photo of Local Circuit - Denton, TX 76201, USA Photo of Local Circuit - Denton, TX 76201, USA
    Details
  • 1
  • 2

Nearby cities:

Aubrey Carrollton Corinth Denton Flower Mound Fort Worth Justin Lewisville Little Elm Prosper Sanger The Colony

People also searched for:

Car Service in Denton Car Repair And Maintenance in Denton Local Repair Services in Denton Repair Services in Denton Brake Repair in Denton Tire Repair Services in Denton Handyman Services in Denton Car Maintenance Station in Denton Car Insurance Companies in Denton Life Insurance Companies in Denton Home Insurance Companies in Denton Handyman in Denton Health Insurance Companies in Denton

More Categories:

Cleaning Services in Denton Public Pools & Water Park in Denton Baby & Pregnancy Stores in Denton Vacation House Rentals in Denton Hospital in Denton Pawnshops in Denton Hotel & Motel & Hostel in Denton Manicure & Pedicure in Denton Clothing Store in Denton Flower Store & Florist in Denton Handyman Services in Denton Nightclub in Denton Cafe & Coffee Shop & Pub in Denton Notary & Lawyer in Denton Sport & School & Kindergarten in Denton Auto Parts in Denton Travel Agency in Denton Theater & Cinema in Denton Pizza & Sushi in Denton Household Appliances in Denton Building Materials in Denton Grocery Store in Denton Audit & Consulting in Denton Beauty Salon in Denton Restaurant in Denton Finance & Loans in Denton Pets in Denton Pharmacy in Denton Taxi & Freight Transport in Denton Furniture in Denton Jewelry in Denton Children's Entertainment in Denton Car Service in Denton Visa Support in Denton Dentistry in Denton Sporting Goods in Denton

List of local businesses, places and services in Texas

⭐ business help 🔍 services ☎ phones 🕒 opening times 🗨 reviews 🌍 addresses, locations 📷 photos

© 2025 Guide.in.ua Privacy Policy