Home
Sign In
Guide > Expert defense attorney in Virginia

Top 30 Best Expert defense attorney in Virginia

1888 results found

Search for local businesses, places and services near you

Choose your location:
Virginia
  • United States
  • Alabama
  • Alaska
  • Arizona
  • Arkansas
  • California
  • Colorado
  • Connecticut
  • Delaware
  • Florida
  • Georgia
  • Hawaii
  • Idaho
  • Illinois
  • Indiana
  • Iowa
  • Kansas
  • Kentucky
  • Louisiana
  • Maine
  • Maryland
  • Massachusetts
  • Michigan
  • Minnesota
  • Mississippi
  • Missouri
  • Montana
  • Nebraska
  • Nevada
  • New Hampshire
  • New Jersey
  • New Mexico
  • New York
  • North Carolina
  • North Dakota
  • Ohio
  • Oklahoma
  • Oregon
  • Pennsylvania
  • Rhode Island
  • South Carolina
  • South Dakota
  • Tennessee
  • Texas
  • Utah
  • Vermont
  • Virginia
  • Washington
  • West Virginia
  • Wisconsin
  • Wyoming
  • Australia
  • France
  • Germany
  • Ireland
  • Italy
  • New Zealand
  • Poland
  • Spain
  • Ukraine
  • United Kingdom
View Map
  • 1
  • ...
  • 9
  • 10
  • 11
  • 12
  • 13
  • ...
  • 63
  • 5 21
    #301

    Ambler Law Offices, LLC

    ● Open
    216 E Main St Suite 200, Front Royal, VA 22630, United States
    (540) 550-4236
    amblerlawoffices.com

    Ambler Law Offices, LLC is a legal institution located at 216 East Main Street, Front Royal, Virginia, United States. Specializing in defending constitutional rights, we offer expert legal representation on a variety of issues.

    Details
  • 5 23
    #302

    John F. O'Neill Castro

    ● Closed
    128 E Main St, Front Royal, VA 22630, United States
    (540) 635-3165
    johnfoneilllawyer.com

    John F. O'Neill Castro is a reputable law firm located at 128 East Main Street in Front Royal, Virginia, United States. Specializing in various areas of law, the institution is known for its dedication to providing top-notch legal services to its clients.

    Photo of John F. O'Neill Castro - 128 East Main Street, Front Royal, VA 22630, USA Photo of John F. O'Neill Castro - 128 East Main Street, Front Royal, VA 22630, USA Photo of John F. O'Neill Castro - 128 East Main Street, Front Royal, VA 22630, USA
    Legal Service
    Details
  • 5 24
    #303

    Obenshain Law Group

    ● Closed
    420 Neff Ave #130, Harrisonburg, VA 22801, United States
    (540) 318-7360
    obenshainlaw.com

    Obenshain Law Group is a reputable law firm located at 420 Neff Avenue in Harrisonburg, Virginia. Specializing in various areas of law, their team of experienced lawyers provides expert legal representation and guidance to clients in need.

    Photo of Obenshain Law Group - 420 Neff Avenue, Harrisonburg, VA 22801, USA Photo of Obenshain Law Group - 420 Neff Avenue, Harrisonburg, VA 22801, USA Photo of Obenshain Law Group - 420 Neff Avenue, Harrisonburg, VA 22801, USA
    Legal Service
    Details
  • 5 23
    #304

    Law Office of David R. Martin

    ● Closed
    51 N Liberty St Suite 101, Harrisonburg, VA 22802, United States
    (540) 217-0265
    davidmartinlawyer.com

    The Law Office of David R. Martin is a reputable legal firm located at 51 North Liberty Street in Harrisonburg, Virginia, United States. Specializing in various areas of law, including criminal defense, personal injury, and family law, Attorney David R.

    Photo of Law Office of David R. Martin - 51 North Liberty Street, Harrisonburg, VA 22802, USA
    Legal Service
    Details
  • 5 35
    #305

    Norton Health Law, P.C.

    ● Closed
    1441 Sachem Pl UNIT 2, Charlottesville, VA 22901, United States
    (434) 978-3100
    nortonhealthlaw.com

    Norton Health Law, P.C. is a reputable law firm located at 1441 Sachem Place in Charlottesville, Virginia, United States.

    Photo of Norton Health Law, P.C. - 1441 Sachem Place, Charlottesville, VA 22901, USA Photo of Norton Health Law, P.C. - 1441 Sachem Place, Charlottesville, VA 22901, USA Photo of Norton Health Law, P.C. - 1441 Sachem Place, Charlottesville, VA 22901, USA
    Legal Service
    Details
  • 5 34
    #306

    The Daniel Law Firm, P.C.

    ● Closed
    3735 Franklin Rd SW PMB 229, Roanoke, VA 24014, United States
    (540) 204-4316
    daniellawfirmpc.com

    The Daniel Law Firm, P.C. is a full-service law firm located at 3735 Franklin Road Southwest in Roanoke, Virginia.

    Bank, Credit Union Financial Service Legal Service
    Details
  • 5 68
    #307

    The Law Offices of Mark T. Hurt

    ● Open
    110 E Main St Suite 104, Salem, VA 24153, United States
    (540) 404-1950
    markhurtlawfirm.com

    The Law Offices of Mark T. Hurt is a reputable legal institution located at 110 East Main Street in Salem, Virginia, United States. Specializing in various areas of law, including personal injury, criminal defense, and family law, Mark T.

    Photo of The Law Offices of Mark T. Hurt - 110 East Main Street, Salem, VA 24153, USA Photo of The Law Offices of Mark T. Hurt - 110 East Main Street, Salem, VA 24153, USA
    Legal Service
    Details
  • 5 100
    #308

    The Law Offices of Mark T. Hurt

    ● Open
    215B E Main St, Wise, VA 24293, United States
    (276) 623-0808
    markhurtlawfirm.com

    The Law Offices of Mark T. Hurt is a respected legal institution located at 215B East Main Street in Wise, Virginia, United States. Specializing in various areas of law, including personal injury, criminal defense, and family law, attorney Mark T.

    Photo of The Law Offices of Mark T. Hurt - 215B East Main Street, Wise, VA 24293, USA Photo of The Law Offices of Mark T. Hurt - 215B East Main Street, Wise, VA 24293, USA Photo of The Law Offices of Mark T. Hurt - 215B East Main Street, Wise, VA 24293, USA
    Legal Service
    Details
  • 5 31
    #309

    The Law Offices of Mark T. Hurt - Annex

    ● Open
    165 W Main St, Abingdon, VA 24210, United States
    (276) 623-0808
    markhurtlawfirm.com

    The Law Offices of Mark T. Hurt - Annex is a reputable legal institution located at 165 West Main Street in Abingdon, Virginia, United States.

    Photo of The Law Offices of Mark T. Hurt - Annex - 165 West Main Street, Abingdon, VA 24210, USA Photo of The Law Offices of Mark T. Hurt - Annex - 165 West Main Street, Abingdon, VA 24210, USA Photo of The Law Offices of Mark T. Hurt - Annex - 165 West Main Street, Abingdon, VA 24210, USA
    Legal Service
    Details
  • 5 227
    #310

    The Law Offices of Mark T. Hurt

    ● Open
    350 S 4th St E, Wytheville, VA 24382, United States
    (276) 623-1070
    markhurtlawfirm.com

    The Law Offices of Mark T. Hurt is a reputable legal institution located at 350 South 4th Street in Wytheville, Virginia. Specializing in various areas of law, including personal injury, criminal defense, and family law, Mark T.

    Photo of The Law Offices of Mark T. Hurt - 350 South 4th Street, Wytheville, VA 24382, USA Photo of The Law Offices of Mark T. Hurt - 350 South 4th Street, Wytheville, VA 24382, USA Photo of The Law Offices of Mark T. Hurt - 350 South 4th Street, Wytheville, VA 24382, USA
    Legal Service
    Details
  • 5 27
    #311

    LefflerPhillips PLC

    ● Closed
    10505 Judicial Dr Suite 200, Fairfax, VA 22030, United States
    (703) 293-9300
    lefflerphillips.com

    LefflerPhillips PLC is a premier law firm located at 10505 Judicial Drive in Fairfax, Virginia.

    Photo of LefflerPhillips PLC - 10505 Judicial Drive, Fairfax, VA 22030, USA Photo of LefflerPhillips PLC - 10505 Judicial Drive, Fairfax, VA 22030, USA Photo of LefflerPhillips PLC - 10505 Judicial Drive, Fairfax, VA 22030, USA
    Legal Service
    Details
  • 5 134
    #312

    Erik M. Pelton & Associates, PLLC

    ● Open
    111 Park Pl, Falls Church, VA 22046, United States
    (703) 525-8009
    erikpelton.business.site

    Erik M. Pelton & Associates, PLLC is a reputable law firm located at 111 Park Place in Falls Church, Virginia. Specializing in trademark law, the firm provides expert legal services to clients in need of protection for their intellectual property rights.

    Photo of Erik M. Pelton & Associates, PLLC - 111 Park Place, Falls Church, VA 22046, USA Photo of Erik M. Pelton & Associates, PLLC - 111 Park Place, Falls Church, VA 22046, USA Photo of Erik M. Pelton & Associates, PLLC - 111 Park Place, Falls Church, VA 22046, USA
    Government Office Legal Service
    Details
  • 5 46
    #313

    Yong G. Kim & Associates

    ● Closed
    7024 Evergreen Ct, Annandale, VA 22003, United States
    (703) 916-0420
    meetoovisa.com

    Yong G. Kim & Associates is a reputable law firm located at 7024 Evergreen Court in Annandale, Virginia, United States.

    Photo of Yong G. Kim & Associates - 7024 Evergreen Court, Annandale, VA 22003, USA Photo of Yong G. Kim & Associates - 7024 Evergreen Court, Annandale, VA 22003, USA
    Legal Service
    Details
  • 5 62
    #314

    The Law Office of Scott C. Nolan, PLLC

    ● Open
    10304 Eaton Pl Suite 100, Fairfax, VA 22030, United States
    (703) 688-9236
    criminaldefenselawyervirginia.com

    The Law Office of Scott C. Nolan, PLLC is a reputable legal institution located at 10304 Eaton Place in Fairfax, Virginia, United States. Specializing in criminal defense, attorney Scott C.

    Photo of The Law Office of Scott C. Nolan, PLLC - 10304 Eaton Place, Fairfax, VA 22030, USA Photo of The Law Office of Scott C. Nolan, PLLC - 10304 Eaton Place, Fairfax, VA 22030, USA Photo of The Law Office of Scott C. Nolan, PLLC - 10304 Eaton Place, Fairfax, VA 22030, USA
    Legal Service
    Details
  • 5 23
    #315

    Law Offices of SRIS, P.C.

    ● Open
    7400 Beaufont Springs Dr Suite 300 Room 359, Richmond, VA 23225, United States
    (804) 201-9009
    srislawyer.com

    The Law Offices of SRIS, P.C. is a reputable legal institution located at 7400 Beaufont Springs Drive in Richmond, Virginia, United States. The owner and CEO, Mr.

    Photo of Law Offices of SRIS, P.C. - 7400 Beaufont Springs Drive, Richmond, VA 23225, USA Photo of Law Offices of SRIS, P.C. - 7400 Beaufont Springs Drive, Richmond, VA 23225, USA Photo of Law Offices of SRIS, P.C. - 7400 Beaufont Springs Drive, Richmond, VA 23225, USA
    Legal Service
    Details
  • 5 57
    #316

    Ronald Page, PLC Law Offices

    ● Closed
    14321 Winter Breeze Dr Ste. 50, Midlothian, VA 23113, United States
    (804) 562-8704
    rpagelaw.com

    Ronald Page, PLC Law Offices is a reputable law firm located at 14321 Winter Breeze Drive in Midlothian, Virginia, United States.

    Photo of Ronald Page, PLC Law Offices - 14321 Winter Breeze Drive, Midlothian, VA 23113, USA
    Legal Service
    Details
  • 5 32
    #317

    James River Law

    ● Closed
    1710 E Franklin St Suite 100, Richmond, VA 23223, United States
    (804) 255-9515
    jamesriverlaw.com

    James River Law is a prestigious law institution located at 1710 East Franklin Street in Richmond, Virginia.

    Photo of James River Law - 1710 East Franklin Street, Richmond, VA 23223, USA Photo of James River Law - 1710 East Franklin Street, Richmond, VA 23223, USA Photo of James River Law - 1710 East Franklin Street, Richmond, VA 23223, USA
    Details
  • 5 25
    #318

    Wolf Law Center

    ● Open
    2400 Old Brick Rd Suite 16, Glen Allen, VA 23060, United States
    (804) 391-7069
    wolflawcenter.com

    Located at 2400 Old Brick Road in Glen Allen, Virginia, the Wolf Law Center is dedicated to providing the best possible outcomes for each and every client.

    Photo of Wolf Law Center - 2400 Old Brick Road, Glen Allen, VA 23060, USA
    Details
  • 5 175
    #319

    Leavitt & Martin, PLLC

    ● Closed
    14413 Justice Rd Suite 1, Midlothian, VA 23113, United States
    (804) 873-4004
    leavittmartinlaw.com

    Leavitt & Martin, PLLC is a reputable law firm located at 14413 Justice Road in Midlothian, Virginia, United States.

    Photo of Leavitt & Martin, PLLC - 14413 Justice Road, Midlothian, VA 23113, USA Photo of Leavitt & Martin, PLLC - 14413 Justice Road, Midlothian, VA 23113, USA Photo of Leavitt & Martin, PLLC - 14413 Justice Road, Midlothian, VA 23113, USA
    Legal Service
    Details
  • 5 47
    #320

    Ben Williams Law

    ● Closed
    8401 Patterson Ave Ste 104, Richmond, VA 23229, United States
    (804) 552-3200
    bwilliams.law

    Ben Williams Law is a reputable legal institution located at 8401 Patterson Avenue in Richmond, Virginia, United States.

    Photo of Ben Williams Law - 8401 Patterson Avenue, Richmond, VA 23229, USA Photo of Ben Williams Law - 8401 Patterson Avenue, Richmond, VA 23229, USA Photo of Ben Williams Law - 8401 Patterson Avenue, Richmond, VA 23229, USA
    Legal Service
    Details
  • 5 23
    #321

    Anthony L White, PLLC

    ● Closed
    5030 Sadler Pl Suite 204, Glen Allen, VA 23060, United States
    (804) 709-1933
    alwhitelaw.com

    Anthony L White, PLLC is a finance and legal institution located at 5030 Sadler Place in Glen Allen, Virginia, United States.

    Photo of Anthony L White, PLLC - 5030 Sadler Place, Glen Allen, VA 23060, USA Photo of Anthony L White, PLLC - 5030 Sadler Place, Glen Allen, VA 23060, USA
    Financial Service Legal Service
    Details
  • 5 26
    #322

    Financial Freedom Legal

    ● Closed
    4801 Hermitage Rd Suite 101, Richmond, VA 23227, United States
    (804) 373-3366
    fflegalva.com

    Financial Freedom Legal is a prestigious law firm located at 4801 Hermitage Road in Richmond, Virginia, United States.

    Photo of Financial Freedom Legal - 4801 Hermitage Road, Richmond, VA 23227, USA Photo of Financial Freedom Legal - 4801 Hermitage Road, Richmond, VA 23227, USA Photo of Financial Freedom Legal - 4801 Hermitage Road, Richmond, VA 23227, USA
    Legal Service
    Details
  • 5 35
    #323

    Fidelity Law Firm, PLLC

    ● Closed
    999 Waterside Dr #2525, Norfolk, VA 23510, United States
    (757) 777-3442
    fidelitylawfirmpllc.com

    Fidelity Law Firm, PLLC is a reputable legal institution located at 999 Waterside Drive in Norfolk, Virginia, United States. Specializing in various areas of law, the firm is committed to providing top-notch legal services to its clients.

    Legal Service
    Details
  • 5 27
    #324

    Lollar Law (Eminent Domain/ Condemnation Lawyers)

    ● Closed
    109 E Main St UNIT 501, Norfolk, VA 23510, United States
    (757) 644-4657
    lollarlaw.com

    Lollar Law is a reputable legal institution specializing in eminent domain and condemnation cases.

    Photo of Lollar Law (Eminent Domain/ Condemnation Lawyers) - 109 East Main Street, Norfolk, VA 23510, USA
    Details
  • 5 128
    #325

    Curcione Law, PLC

    ● Open
    999 Waterside Dr #2525, Norfolk, VA 23510, United States
    (757) 777-3700
    norfolkcriminaldefenseattorneys.com

    Curcione Law, PLC is a law firm located at 999 Waterside Drive in Norfolk, Virginia, United States. Specializing in criminal defense, our team is led by founding attorney Matt Curcione, a former police officer with nearly a decade of experience.

    Photo of Curcione Law, PLC - 999 Waterside Drive, Norfolk, VA 23510, USA Photo of Curcione Law, PLC - 999 Waterside Drive, Norfolk, VA 23510, USA
    Legal Service
    Details
  • 5 46
    #326

    RICHARD B. CAMPBELL, PLC

    ● Closed
    3300 Tyre Neck Rd SUITE 2, Portsmouth, VA 23703, United States
    (757) 809-5900
    law757.com

    RICHARD B. CAMPBELL, PLC is a reputable law firm located at 3300 Tyre Neck Road in Portsmouth, Virginia, United States.

    Photo of RICHARD B. CAMPBELL, PLC - 3300 Tyre Neck Road, Portsmouth, VA 23703, USA
    Legal Service
    Details
  • 5 29
    #327

    Welch & Wright, PLLC

    ● Closed
    716 W 20th St, Norfolk, VA 23517, United States
    (757) 707-8803
    welchwrightlaw.com

    Welch & Wright, PLLC is a reputable law firm located in Norfolk, Virginia. Our experienced team of lawyers is dedicated to providing top-notch legal services to our clients.

    Photo of Welch & Wright, PLLC - 716 West 20th Street, Norfolk, VA 23517, USA Photo of Welch & Wright, PLLC - 716 West 20th Street, Norfolk, VA 23517, USA Photo of Welch & Wright, PLLC - 716 West 20th Street, Norfolk, VA 23517, USA
    Legal Service
    Details
  • 5 129
    #328

    Dorsk Law Office, Plc

    ● Closed
    409 Duke St Suite 100, Norfolk, VA 23510, United States
    (757) 423-0271
    dorsklaw.com

    Dorsk Law Office, Plc is a reputable law firm located at 409 Duke Street in Norfolk, Virginia, United States.

    Photo of Dorsk Law Office, Plc - 409 Duke Street, Norfolk, VA 23510, USA Photo of Dorsk Law Office, Plc - 409 Duke Street, Norfolk, VA 23510, USA Photo of Dorsk Law Office, Plc - 409 Duke Street, Norfolk, VA 23510, USA
    Legal Service
    Details
  • 5 311
    #329

    Peter John Louie, P.C.

    ● Closed
    5265 Providence Rd STE 300, Virginia Beach, VA 23464, United States
    (757) 384-4357
    peterlouielaw.com

    Peter John Louie, P.C. is a reputable law firm located at 5265 Providence Road in Virginia Beach, Virginia. As a dedicated team of legal professionals, we specialize in providing expert legal counsel and representation in various areas of law.

    Photo of Peter John Louie, P.C. - 5265 Providence Road, Virginia Beach, VA 23464, USA Photo of Peter John Louie, P.C. - 5265 Providence Road, Virginia Beach, VA 23464, USA Photo of Peter John Louie, P.C. - 5265 Providence Road, Virginia Beach, VA 23464, USA
    Legal Service
    Details
  • 5 36
    #330

    Waldrop & Colvin

    ● Closed
    780 Lynnhaven Pkwy #400, Virginia Beach, VA 23452, United States
    (757) 354-2167
    thelawdept.com

    Waldrop & Colvin is a reputable law firm located at 780 Lynnhaven Parkway in Virginia Beach, Virginia, United States.

    Photo of Waldrop & Colvin - 780 Lynnhaven Parkway, Virginia Beach, VA 23452, USA Photo of Waldrop & Colvin - 780 Lynnhaven Parkway, Virginia Beach, VA 23452, USA Photo of Waldrop & Colvin - 780 Lynnhaven Parkway, Virginia Beach, VA 23452, USA
    Legal Service
    Details
  • 1
  • ...
  • 9
  • 10
  • 11
  • 12
  • 13
  • ...
  • 63

Nearby cities:

Abingdon Aldie Alexandria Annandale Appomattox Arlington Ashburn Ashland Bedford Berryville Big Stone Gap Bluefield Bon Air Bristol Burke Centreville Chantilly Charlottesville Chesapeake Chester Chesterfield Colonial Heights Covington Culpeper Dublin Dumfries Elkton Fairfax Falls Church Fishersville Forest Fredericksburg Front Royal Gainesville Galax Glen Allen Great Falls Grundy Hampton Harrisonburg Haymarket Henrico Herndon Hopewell Kilmarnock King George Lebanon Leesburg Lexington Locust Grove Lorton Luray Lynchburg Madison Heights Manassas Marion McLean Mechanicsville Middleburg Midlothian Newport News Norfolk Norton Orange Pearisburg Petersburg Portsmouth Powhatan Prince George Pulaski Radford Reston Richlands Richmond Roanoke Salem Smithfield Springfield Stafford Staunton Stephens City Sterling Strasburg Stuart Suffolk Tazewell Tysons Vienna Vinton Virginia Beach Warrenton Washington Waynesboro Williamsburg Winchester Wise Woodbridge Woodstock Wytheville Yorktown

People also searched for:

Lawyer in Virginia Law Company in Virginia Health Insurance Companies in Virginia Immigration Lawyer in Virginia

More Categories:

Building Materials in Virginia Clothing Store in Virginia Pizza & Sushi in Virginia Auto Parts in Virginia Grocery Store in Virginia Hotel & Motel & Hostel in Virginia Notary & Lawyer in Virginia Cleaning Services in Virginia Finance & Loans in Virginia Restaurant in Virginia Theater & Cinema in Virginia Dentistry in Virginia Flower Store & Florist in Virginia Audit & Consulting in Virginia Visa Support in Virginia Household Appliances in Virginia Pharmacy in Virginia Baby & Pregnancy Stores in Virginia Jewelry in Virginia Furniture in Virginia Public Pools & Water Park in Virginia Hospital in Virginia Nightclub in Virginia Manicure & Pedicure in Virginia Pets in Virginia Beauty Salon in Virginia Sporting Goods in Virginia Pawnshops in Virginia Children's Entertainment in Virginia Vacation House Rentals in Virginia Sport & School & Kindergarten in Virginia Cafe & Coffee Shop & Pub in Virginia Travel Agency in Virginia Car Service in Virginia Handyman Services in Virginia Taxi & Freight Transport in Virginia

List of local businesses, places and services in Virginia

⭐ business help 🔍 services ☎️phones ⌚️opening times ✍️reviews 📍 addresses, locations 🖼️ photos

© 2025 Guide.in.ua Privacy Policy