Home
Sign In
Guide > Mental clarity in California > Mental clarity in Ventura

Mental clarity in Ventura, California

129 results found

Search for local businesses, places and services near you

Choose your location:
California
  • United States
  • Alabama
  • Alaska
  • Arizona
  • Arkansas
  • California
  • Colorado
  • Connecticut
  • Delaware
  • Florida
  • Georgia
  • Hawaii
  • Idaho
  • Illinois
  • Indiana
  • Iowa
  • Kansas
  • Kentucky
  • Louisiana
  • Maine
  • Maryland
  • Massachusetts
  • Michigan
  • Minnesota
  • Mississippi
  • Missouri
  • Montana
  • Nebraska
  • Nevada
  • New Hampshire
  • New Jersey
  • New Mexico
  • New York
  • North Carolina
  • North Dakota
  • Ohio
  • Oklahoma
  • Oregon
  • Pennsylvania
  • Rhode Island
  • South Carolina
  • South Dakota
  • Tennessee
  • Texas
  • Utah
  • Vermont
  • Virginia
  • Washington
  • West Virginia
  • Wisconsin
  • Wyoming
  • Australia
  • France
  • Germany
  • Ireland
  • Italy
  • New Zealand
  • Poland
  • Spain
  • Ukraine
  • United Kingdom
View Map
  • 1
  • 2
  • 3
  • 4
  • 5
5 185
#1

Persistence Culture Crossfit - Ventura

● Closed
3503 Arundell Circle, Ventura, California 93003, United States
805-622-2910
persistenceculture.com

Welcome to Persistence Culture Crossfit - Ventura, where we redefine fitness and lifestyle at 3503 Arundell Circle, Ventura, California.

Photo of Persistence Culture Crossfit - Ventura - Ventura, CA 93003, USA Photo of Persistence Culture Crossfit - Ventura - Ventura, CA 93003, USA Photo of Persistence Culture Crossfit - Ventura - Ventura, CA 93003, USA
Exercise Gym Medical Services
Details
4.9 356
#2

All In Solutions Detox

● Open
1856 Deodora St, Simi Valley, CA 93065, United States
818-938-2177
allinsolutions.com

than just getting sober; it's about addressing the underlying issues that contribute to addiction. All In Solutions Detox is dedicated to providing comprehensive care that helps clients heal physically, emotionally, and psychologically.

Photo of All In Solutions Detox - Simi Valley, CA 93065, USA Photo of All In Solutions Detox - Simi Valley, CA 93065, USA Photo of All In Solutions Detox - Simi Valley, CA 93065, USA
Medical Services
Details
4.8 69
#3

Ventura Center for Advanced Therapeutics (Ketamine Clinic): Stefany Wolfsohn, MD

● Closed
4000 Calle Tecate STE 221, Camarillo, CA 93012, United States
805-377-2243
ketaminemed.com

The Ventura Center for Advanced Therapeutics, also known as the Ketamine Clinic, is led by Dr. Stefany Wolfsohn, MD.

Photo of Ventura Center for Advanced Therapeutics (Ketamine Clinic): Stefany Wolfsohn, MD - Camarillo, CA 93012, USA Photo of Ventura Center for Advanced Therapeutics (Ketamine Clinic): Stefany Wolfsohn, MD - Camarillo, CA 93012, USA Photo of Ventura Center for Advanced Therapeutics (Ketamine Clinic): Stefany Wolfsohn, MD - Camarillo, CA 93012, USA
Medical Services
Details
4.6 21
#4

Ventura Buddhist Center - An Lac Mission

● Open
901 South Saticoy Avenue, Ventura, California 93004, United States
805-659-9751
venturabuddhistcenter.org

Welcome to the Ventura Buddhist Center - An Lac Mission, a serene sanctuary nestled in the heart of Ventura, California.

Photo of Ventura Buddhist Center - An Lac Mission - Ventura, CA 93004, USA Photo of Ventura Buddhist Center - An Lac Mission - Ventura, CA 93004, USA Photo of Ventura Buddhist Center - An Lac Mission - Ventura, CA 93004, USA
Exercise Gym Medical Services Place Of Worship
Details
5 7
#5

Ayla Wellness Ventura | Ketamine Assisted Therapy

● Closed
1106 S Seaward Ave, Ventura, CA 93001, United States
805-272-0969
aylawellness.com

Ayla Wellness Ventura is a leading provider of Ketamine Assisted Therapy located in Ventura, California.

Photo of Ayla Wellness Ventura | Ketamine Assisted Therapy - Ventura, CA 93001, USA Photo of Ayla Wellness Ventura | Ketamine Assisted Therapy - Ventura, CA 93001, USA Photo of Ayla Wellness Ventura | Ketamine Assisted Therapy - Ventura, CA 93001, USA
Medical Services
Details
#6

Ventura Acupuncture Clinic

● Open
970 S Petit Ave # D, Ventura, CA 93004, United States
805-901-1906
venturaacupunctureclinic.com

Ventura Acupuncture Clinic is a premier health institution located in Ventura, California. Our clinic is dedicated to providing top-quality acupuncture services to help improve the health and well-being of our patients.

Photo of Ventura Acupuncture Clinic - Ventura, CA 93004, USA Photo of Ventura Acupuncture Clinic - Ventura, CA 93004, USA
Medical Services
Details
#7

Luminous Clarity Family Therapy Inc

● Closed
3717 Thousand Oaks Blvd, Westlake Village, CA 91362, United States
805-267-1869
luminous-clarity.com

Luminous Clarity Family Therapy Inc is a leading health institution located at 3717 Thousand Oaks Boulevard in Westlake Village, California, United States.

Photo of Luminous Clarity Family Therapy Inc - Westlake Village, CA 91362, USA Photo of Luminous Clarity Family Therapy Inc - Westlake Village, CA 91362, USA
Medical Services
Details
#8

Peptide Therapy in Moorpark

● Open
331 Los Angeles Ave, Moorpark, CA 93021, United States
moorpark.mdhrt.com

Peptide Therapy in Moorpark is a cutting-edge health institution located at 331 Los Angeles Avenue in Moorpark, California.

Medical Services
Details
#9

Ventura Primary Care Doctor - Telemedicine Available

● Closed
1500 Palma Drive, Ventura, California 93003, United States
onlinemedicalclinics.com

Welcome to Ventura Primary Care Doctor - Telemedicine Available, your trusted virtual medical clinic located at 1500 Palma Drive, Ventura, California 93003.

Medical Services
Details
5 29
#10

Butterfly Kisses; a holistic approach

● Closed
2660 E Main St Ste 104, Ventura, CA 93003, United States
203-232-8751
bk-holistic.com

Butterfly Kisses is a holistic health and spa institution located at 2660 East Main Street in Ventura, California. We offer a unique and comprehensive approach to wellness, focusing on the mind, body, and spirit.

Photo of Butterfly Kisses; a holistic approach - Ventura, CA 93003, USA Photo of Butterfly Kisses; a holistic approach - Ventura, CA 93003, USA Photo of Butterfly Kisses; a holistic approach - Ventura, CA 93003, USA
Day Spa Medical Services
Details
5 233
#11

Yu Dayi Chinese Medicine Clinic

● Closed
530 E Los Angeles Ave UNIT 104, Moorpark, CA 93021, United States
805-523-9155
yudayimedicine.com

Yu Dayi Chinese Medicine Clinic is a reputable health institution located at 530 East Los Angeles Avenue in Moorpark, California, United States.

Photo of Yu Dayi Chinese Medicine Clinic - Moorpark, CA 93021, USA Photo of Yu Dayi Chinese Medicine Clinic - Moorpark, CA 93021, USA Photo of Yu Dayi Chinese Medicine Clinic - Moorpark, CA 93021, USA
Medical Services
Details
5 27
#12

Castano Wellness

● Closed
1429 E Thousand Oaks Blvd suite 103, Thousand Oaks, CA 91362, United States
805-206-7615
beckycastano.com

Castano Wellness is a health institution located at 1429 East Thousand Oaks Boulevard in Thousand Oaks, California. Specializing in acupuncture and cupping therapy, Castano Wellness has been serving the community since 2011.

Photo of Castano Wellness - Thousand Oaks, CA 91362, USA Photo of Castano Wellness - Thousand Oaks, CA 91362, USA Photo of Castano Wellness - Thousand Oaks, CA 91362, USA
Medical Services
Details
5 27
#13

Bodhi Salt Yoga

● Closed
175 S Ventura Ave #103B, Ventura, CA 93001, United States
805-628-9099
bodhisaltyoga.com

Bodhi Salt Yoga is a unique gym and health institution located at 175 South Ventura Avenue in Ventura, California. Our facility offers a serene and peaceful environment for individuals to practice yoga and improve their overall well-being.

Photo of Bodhi Salt Yoga - Ventura, CA 93001, USA Photo of Bodhi Salt Yoga - Ventura, CA 93001, USA Photo of Bodhi Salt Yoga - Ventura, CA 93001, USA
Exercise Gym Medical Services
Details
5 77
#14

Functional Health + Wellness

● Closed
231 Village Commons Blvd UNIT 19, Camarillo, CA 93012, United States
805-586-4694
fhwellness-ca.com

Functional Health Wellness is a premier health and wellness institution located in the heart of Camarillo, California. Our dedicated team of professionals offers a range of services designed to promote overall well-being and vitality.

Photo of Functional Health + Wellness - Camarillo, CA 93012, USA Photo of Functional Health + Wellness - Camarillo, CA 93012, USA Photo of Functional Health + Wellness - Camarillo, CA 93012, USA
Day Spa Medical Services
Details
5 27
#15

Binkley Healing Center

● Closed
961 East Main Street, Ventura, California 93001, United States
805-641-9000
binkleyhc.com

Welcome to Binkley Healing Center, your premier destination for health and wellness in Ventura, California. Conveniently located at 961 East Main Street, our center is dedicated to helping you achieve optimal health through a holistic approach.

Photo of Binkley Healing Center - Ventura, CA 93001, USA Photo of Binkley Healing Center - Ventura, CA 93001, USA Photo of Binkley Healing Center - Ventura, CA 93001, USA
Exercise Gym Medical Services
Details
5 24
#16

Mindset Fitness

● Closed
4310 Tradewinds Drive, Oxnard, California 93035, United States
805-834-3038
mymindsetfitness.com

Welcome to Mindset Fitness, your premier destination for holistic wellness and personal transformation in Oxnard, California.

Photo of Mindset Fitness - Oxnard, CA 93035, USA Photo of Mindset Fitness - Oxnard, CA 93035, USA Photo of Mindset Fitness - Oxnard, CA 93035, USA
Exercise Gym Medical Services
Details
5 84
#17

Persistence Culture Crossfit - Camarillo

● Closed
409 Calle San Pablo, Camarillo, California 93012, United States
805-624-3618
persistenceculture.com

Welcome to Persistence Culture Crossfit - Camarillo, where elite fitness meets community and diversity at our state-of-the-art gym located at 409 Calle San Pablo, Camarillo, California.

Photo of Persistence Culture Crossfit - Camarillo - Camarillo, CA 93012, USA Photo of Persistence Culture Crossfit - Camarillo - Camarillo, CA 93012, USA Photo of Persistence Culture Crossfit - Camarillo - Camarillo, CA 93012, USA
Exercise Gym Medical Services
Details
5 46
#18

Persistence Culture CrossFit - Moorpark

● Closed
718 New Los Angeles Avenue, Moorpark, California 93021, United States
805-669-9637
persistenceculture.com

Welcome to Persistence Culture CrossFit - Moorpark, your ultimate destination for a transformative fitness journey.

Photo of Persistence Culture CrossFit - Moorpark - Moorpark, CA 93021, USA Photo of Persistence Culture CrossFit - Moorpark - Moorpark, CA 93021, USA Photo of Persistence Culture CrossFit - Moorpark - Moorpark, CA 93021, USA
Exercise Gym Medical Services
Details
4.9 73
#19

Ojai Massage

● Closed
307 E Ojai Ave #203, Ojai, CA 93023, United States
805-798-1289
ojaimassage.com

Ojai Massage is a health institution located at 307 East Ojai Avenue in Ojai, California. Situated in the surrounding peaceful environment of downtown Ojai, our oasis offers a space for locals and visitors to rejuvenate their body and spirit.

Photo of Ojai Massage - Ojai, CA 93023, USA Photo of Ojai Massage - Ojai, CA 93023, USA Photo of Ojai Massage - Ojai, CA 93023, USA
Medical Services
Details
4.8 309
#20

Boku Superfood

● Closed
987 W Ojai Ave, Ojai, CA 93023, United States
805-650-2658
bokusuperfood.com

Boku Superfood is a health-focused institution located at 987 West Ojai Avenue in Ojai, California, United States. This establishment is a one-stop destination for all things nutritious and delicious, offering a range of organic and natural products.

Photo of Boku Superfood - Ojai, CA 93023, USA Photo of Boku Superfood - Ojai, CA 93023, USA Photo of Boku Superfood - Ojai, CA 93023, USA
Food Establishment Grocery Store Internet Cafe Lodging Business Restaurant Store
Details
4.8 21
#21

Center for Integrative Change

● Closed
3585 Maple St #233, Ventura, CA 93003, United States
805-256-3497
centerforintegrativechange.com

The Center for Integrative Change is a leading health institution located at 3585 Maple Street in Ventura, California, United States.

Photo of Center for Integrative Change - Ventura, CA 93003, USA Photo of Center for Integrative Change - Ventura, CA 93003, USA Photo of Center for Integrative Change - Ventura, CA 93003, USA
Medical Services
Details
4.8 22
#22

Michael Kaufman, M.F.T., Psy.D.

● Closed
3625 Thousand Oaks Blvd, Thousand Oaks, CA 91362, United States
818-730-2960
westlakevillagefamilyservices.com

Michael Kaufman, M.F.T., Psy.D. is a reputable health institution located at 3625 Thousand Oaks Boulevard in Thousand Oaks, California, United States. Dr. Kaufman is a licensed Marriage and Family Therapist (M.

Medical Services
Details
4.8 20
#23

Serenity Therapy, Inc.- Sherman Oaks Therapist

● Closed
13949 Ventura Blvd # 210, Sherman Oaks, CA 91423, United States
626-684-4906
adrinedavtyan.com

Serenity Therapy, Inc. is a tranquil oasis located in Sherman Oaks, Los Angeles. Our team of dedicated therapists are committed to providing a safe and supportive environment for individuals seeking healing and growth.

Photo of Serenity Therapy, Inc.- Sherman Oaks Therapist - Los Angeles, CA 91423, USA Photo of Serenity Therapy, Inc.- Sherman Oaks Therapist - Los Angeles, CA 91423, USA Photo of Serenity Therapy, Inc.- Sherman Oaks Therapist - Los Angeles, CA 91423, USA
Medical Services
Details
4.5 60
#24

Little Sama Ojai

● Closed
345 E Ojai Ave A, Ojai, CA 93023, United States
805-335-4175
littlesamaojai.com

Little Sama Ojai is a charming restaurant located at 345 East Ojai Avenue in Ojai, California. This cozy eatery offers a delightful dining experience with a menu featuring a variety of delicious dishes.

Photo of Little Sama Ojai - Ojai, CA 93023, USA Photo of Little Sama Ojai - Ojai, CA 93023, USA Photo of Little Sama Ojai - Ojai, CA 93023, USA
Food Establishment Restaurant
Details
4.4 66
#25

The Vitamin Shoppe

● Closed
4860 Telephone Road, Ventura, California 93003, United States
805-642-1072
locations.vitaminshoppe.com

Welcome to The Vitamin Shoppe, your one-stop destination for all things health and wellness, conveniently located at 4860 Telephone Road, Ventura, California 93003.

Photo of The Vitamin Shoppe - Ventura, CA 93003, USA Photo of The Vitamin Shoppe - Ventura, CA 93003, USA Photo of The Vitamin Shoppe - Ventura, CA 93003, USA
Food Establishment Grocery Store Medical Services Store
Details
5 11
#26

The Healthy Place - Thousand Oaks

● Closed
140 W Hillcrest Dr #121, Thousand Oaks, CA 91360, United States
805-371-5721
thehealthyplaceto.com

The Healthy Place in Thousand Oaks is a premier destination for all things related to food and health. Located at 140 West Hillcrest Drive in Thousand Oaks, California, this store offers a wide range of products to support a healthy lifestyle.

Photo of The Healthy Place - Thousand Oaks - Thousand Oaks, CA 91360, USA Photo of The Healthy Place - Thousand Oaks - Thousand Oaks, CA 91360, USA Photo of The Healthy Place - Thousand Oaks - Thousand Oaks, CA 91360, USA
Food Establishment Medical Services Store
Details
5 10
#27

Alignment Healings

● Closed
206 N Signal St m, Ojai, CA 93023, United States
818-853-3033
alignmenthealings.com

Alignment Healings is a holistic health institution located in the serene town of Ojai, California. Our dedicated team of practitioners offers a range of healing modalities to help you achieve physical, mental, and emotional alignment.

Photo of Alignment Healings - Ojai, CA 93023, USA Photo of Alignment Healings - Ojai, CA 93023, USA Photo of Alignment Healings - Ojai, CA 93023, USA
Medical Services
Details
5 1
#28

Float Mandalay Beach

● Closed
2101 Mandalay Beach Rd, Oxnard, CA 93035, United States
805-760-9017
floatmandalaybeach.com

Float Mandalay Beach is a luxurious spa located at 2101 Mandalay Beach Road in Oxnard, California. This tranquil oasis offers a unique experience of floating in warm saltwater tanks, allowing guests to relax and rejuvenate both body and mind.

Photo of Float Mandalay Beach - Oxnard, CA 93035, USA Photo of Float Mandalay Beach - Oxnard, CA 93035, USA Photo of Float Mandalay Beach - Oxnard, CA 93035, USA
Day Spa
Details
5 5
#29

Natural Healthcare Center

● Closed
1347 Aliso Pl, Ventura, CA 93001, United States
805-497-4074

The Natural Healthcare Center is a holistic health institution located at 1347 Aliso Place in Ventura, California, United States. Our center offers a wide range of natural and alternative healthcare services to promote overall wellness and healing.

Medical Services
Details
5 8
#30

Horizon Healing | Ketamine Therapy

● Closed
1363 Donlon St STE 17, Ventura, CA 93003, United States
horizonhealing.co

Horizon Healing | Ketamine Therapy is a health institution located at 1363 Donlon Street in Ventura, California, United States. Our mission is to provide intentional, supportive, and integrative Ketamine Assisted Therapy in Ventura and Ojai.

Photo of Horizon Healing | Ketamine Therapy - Ventura, CA 93003, USA Photo of Horizon Healing | Ketamine Therapy - Ventura, CA 93003, USA Photo of Horizon Healing | Ketamine Therapy - Ventura, CA 93003, USA
Medical Services
Details
  • 1
  • 2
  • 3
  • 4
  • 5

Nearby cities:

Calabasas Camarillo Long Beach Los Angeles Moorpark Ojai Oxnard Port Hueneme Simi Valley Thousand Oaks Ventura Westlake Village

People also searched for:

Medical Clinic in Ventura Clinic in Ventura Psychotherapy in Ventura Therapist in Ventura Beauty Treatments in Ventura Sushi Delivery in Ventura Restaurants in Ventura French Restaurant in Ventura Family Psychologist in Ventura Thai Restaurant in Ventura Sushi in Ventura Chinese Restaurant in Ventura Japanese Restaurant in Ventura French Cuisine Restaurant in Ventura Oriental Restaurant in Ventura Fine Dining Restaurant in Ventura

More Categories:

Visa Support in Ventura Restaurant in Ventura Grocery Store in Ventura Handyman Services in Ventura Finance & Loans in Ventura Baby & Pregnancy Stores in Ventura Vacation House Rentals in Ventura Hotel & Motel & Hostel in Ventura Public Pools & Water Park in Ventura Household Appliances in Ventura Car Service in Ventura Taxi & Freight Transport in Ventura Clothing Store in Ventura Auto Parts in Ventura Flower Store & Florist in Ventura Dentistry in Ventura Cafe & Coffee Shop & Pub in Ventura Children's Entertainment in Ventura Audit & Consulting in Ventura Manicure & Pedicure in Ventura Pharmacy in Ventura Cleaning Services in Ventura Sport & School & Kindergarten in Ventura Notary & Lawyer in Ventura Pizza & Sushi in Ventura Travel Agency in Ventura Hospital in Ventura Furniture in Ventura Pets in Ventura Theater & Cinema in Ventura Sporting Goods in Ventura Jewelry in Ventura Nightclub in Ventura Beauty Salon in Ventura Building Materials in Ventura Pawnshops in Ventura

List of local businesses, places and services in California

⭐ business help 🔍 services ☎ phones 🕒 opening times 🗨 reviews 🌍 addresses, locations 📷 photos

© 2025 Guide.in.ua Privacy Policy